| 产品详情 |
| Edit |   |
| Antigenic Specificity | Dynactin Subunit 2/DCTN2/DCTN-50 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and WB reactivity reported in (PMID: 25669897). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Dynactin Subunit 2/DCTN2/DCTN-50 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dynactin Subunit 2/DCTN2/DCTN-50. This antibody reacts with human, mouse, rat. The Dynactin Subunit 2/DCTN2/DCTN-50 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Dynactin Subunit 2/DCTN2/DCTN-50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL |
| Other Names | DCTN-50, DCTN5050 kD dynein-associated polypeptide, dynactin 2 (p50), dynactin complex 50 kD subunit, Dynactin complex 50 kDa subunit, dynactin subunit 2,50 kDa dynein-associated polypeptide, DYNAMITIN, p50 dynamitin, RBP50 |
| Gene, Accession # | DCTN2, Gene ID: 10540 |
| Catalog # | NBP1-85277 |
| Price | |
| Order / More Info | Dynactin Subunit 2/DCTN2/DCTN-50 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25669897 |
| 产品资料 |
|
|