| Edit |   |
|---|
| Antigenic Specificity | Round Spermatid Basic Protein 1 (RSBN1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RSBN1 may be involved in protein binding. |
|---|
| Immunogen | RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG |
|---|
| Other Names | ROSBIN|RP11-324J2.1|C230004D03Rik|E330004N01|Rosbin|Rsbn|Rsbp|mKIAA3002|RGD1307231 |
|---|
| Gene, Accession # | Gene ID: 54665 |
|---|
| Catalog # | ABIN632562 |
|---|
| Price | |
|---|
| Order / More Info | Round Spermatid Basic Protein 1 (RSBN1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|