| Edit |   |
|---|
| Antigenic Specificity | BTNL8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 32%, rat 32%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human BTNL8 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQA |
|---|
| Other Names | butyrophilin-like 8, BTN9.2, FLJ21458 |
|---|
| Gene, Accession # | Gene ID: 79908, UniProt: Q6UX41, ENSG00000113303 |
|---|
| Catalog # | HPA039738 |
|---|
| Price | |
|---|
| Order / More Info | BTNL8 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|