| Edit |   |
|---|
| Antigenic Specificity | SCAND3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCAND3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCAND3. This antibody reacts with human. The SCAND3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human SCAND3The immunogen for this antibody is SCAND3. Peptide sequence ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH. |
|---|
| Other Names | dJ1186N24.3, dJ1186N24.3 (novel zinc finger protein), SCAN domain containing 3, ZNF305P2, ZNF452 |
|---|
| Gene, Accession # | SCAND3, Gene ID: 114821, Accession: NP_443155, SwissProt: NP_443155 |
|---|
| Catalog # | NBP1-79266 |
|---|
| Price | |
|---|
| Order / More Info | SCAND3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|