| Edit |   |
|---|
| Antigenic Specificity | SCAND2 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SCAND2 Antibody - middle region |
|---|
| Immunogen | The immunogen for anti-SCAND2 antibody: synthetic peptide directed towards the middle region of human SCAND2. Synthetic peptide located within the following region: IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL |
|---|
| Other Names | SCAND2, SCAN domain containing 2 pseudogene |
|---|
| Gene, Accession # | SCAND2P, Accession: NM_033640 |
|---|
| Catalog # | TA344427 |
|---|
| Price | |
|---|
| Order / More Info | SCAND2 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|