| Edit |   |
|---|
| Antigenic Specificity | TROVE Domain Family, Member 2 (TROVE2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation. |
|---|
| Immunogen | TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS |
|---|
| Other Names | SSA2|TROVE2|ssa2|ssa2-A|RO60|RORNP|1810007I17Rik|A530054J02Rik|AI646302|SS-A/Ro|Ssa|Ssa2 |
|---|
| Gene, Accession # | Gene ID: 6738 |
|---|
| Catalog # | ABIN629945 |
|---|
| Price | |
|---|
| Order / More Info | TROVE Domain Family, Member 2 (TROVE2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|