| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Viperin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Viperin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Viperin. This antibody reacts with human. The Viperin Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Viperin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDAL |
|---|
| Other Names | 2510004L01Rik, cig33, cig5, Cytomegalovirus-induced gene 5 protein, interferon-inducible, radical S-adenosyl methionine domain containing 2, radical S-adenosyl methionine domain-containing protein 2, vig1, Viperin, Virus inhibitory protein, endoplasmic reticulum-associated |
|---|
| Gene, Accession # | RSAD2, Gene ID: 91543 |
|---|
| Catalog # | NBP2-58186 |
|---|
| Price | |
|---|
| Order / More Info | Viperin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|