| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MNAB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MNAB Antibody from Novus Biologicals is a rabbit polyclonal antibody to MNAB. This antibody reacts with human. The MNAB Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV |
|---|
| Other Names | FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164 |
|---|
| Gene, Accession # | RC3H2, Gene ID: 54542 |
|---|
| Catalog # | NBP2-68785 |
|---|
| Price | |
|---|
| Order / More Info | MNAB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|