| 产品详情 |
| Edit |   |
| Antigenic Specificity | DDX56 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DDX56 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX56. This antibody reacts with human, mouse, rat. The DDX56 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat DDX56 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS |
| Other Names | ATP-dependent 61 kDa nucleolar RNA helicase, DDX26, DEAD (Asp-Glu-Ala-Asp) box polypeptide 56, DEAD box protein 21, DEAD box protein 56, DEAD-box RNA helicase, EC 3.6.1, EC 3.6.4.13,61-kd nucleolar helicase, NOH61DDX21, probable ATP-dependent RNA helicase DDX56, putative nucleolar RNA helicase |
| Gene, Accession # | DDX56, Gene ID: 54606, Accession: Q9NY93 |
| Catalog # | NBP1-80990 |
| Price | |
| Order / More Info | DDX56 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|