| Edit |   |
|---|
| Antigenic Specificity | Arpin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Arpin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Arpin. This antibody reacts with mouse. The Arpin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD. |
|---|
| Other Names | 2610034B18Rik, C15orf38, RIKEN cDNA 2610034B18 gene |
|---|
| Gene, Accession # | C15ORF38, Gene ID: 348110, Accession: NP_081696 |
|---|
| Catalog # | NBP1-91468-20ul |
|---|
| Price | |
|---|
| Order / More Info | Arpin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|