| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RCAN3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RCAN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RCAN3. This antibody reacts with human. The RCAN3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RCAN3(RCAN family member 3) The peptide sequence was selected from the middle region of RCAN3. Peptide sequence PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA. |
|---|
| Other Names | Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5, hRCN3, Myocyte-enriched calcineurin-interacting protein 3, RCAN family member 3, RCN3, Regulator of calcineurin 3, regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2, regulator of calcineurin 3 isoform 1b2,34,5, regulator of calcineurin 3 isoform 1c2,34,5, regulator of calcineurin 3 isoform 1c3,45,calcipressin-3 |
|---|
| Gene, Accession # | RCAN3, Gene ID: 11123 |
|---|
| Catalog # | NBP1-58949-20ul |
|---|
| Price | |
|---|
| Order / More Info | RCAN3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|