| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MEF2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for MEF2C detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. MEF2C(myocyte enhancer factor 2C), also called MADS box transcription enhancer factor 2, polypeptide C, is a protein that in humans is encoded by the MEF2C gene. MEF2C is a transcription factor in the Mef2 family. MEF2C, however, is induced late during myogenic differentiation and has a strict tissue-specific pattern of expression not seen in MEF2A or MEF2B. By fluorescence in situ hybridization, the human MEF2C is mapped to chromosome 5q14, a region with homology of synteny to the mouse location.MEF2C may be involved with maintenance of the differentiated state. Both MEF2A and Mef2c programmed similar profiles of gene expression in the heart that included genes involved in extracellular matrix remodeling, ion handling, and metabolism. NCOA2 mediates the coactivation of MEF2C-dependent transcription through interaction with the MADS box domain of MEF2C. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT). |
|---|
| Other Names | Myocyte-specific enhancer factor 2C ; Myocyte enhancer factor 2C |
|---|
| Gene, Accession # | MEF2C, UniProt: Q06413 |
|---|
| Catalog # | A01131-1 |
|---|
| Price | |
|---|
| Order / More Info | MEF2C Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|