| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SH3RF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SH3RF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3RF2. This antibody reacts with human. The SH3RF2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SH3RF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE |
|---|
| Other Names | EC 6.3.2, EC 6.3.2.-, Heart protein phosphatase 1-binding protein, HEPP1FLJ23654, MGC149788, MGC149789, putative E3 ubiquitin-protein ligase SH3RF2, RING finger protein 158, RNF158MGC90410, SH3 domain containing ring finger 2, SH3 domain-containing RING finger protein 2 |
|---|
| Gene, Accession # | SH3RF2, Gene ID: 153769, Accession: Q8TEC5, SwissProt: Q8TEC5 |
|---|
| Catalog # | NBP2-38841 |
|---|
| Price | |
|---|
| Order / More Info | SH3RF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|