| Edit |   |
|---|
| Antigenic Specificity | RAD18 Homolog (S. Cerevisiae) (RAD18) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAD18 is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. |
|---|
| Immunogen | RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI |
|---|
| Other Names | zgc:55577|RAD18|DDBDRAFT_0218120|DDBDRAFT_0304878|DDB_0218120|DDB_0304878|DKFZp469H0810|RNF73|2810024C04Rik|Rad18sc |
|---|
| Gene, Accession # | Gene ID: 56852 |
|---|
| Catalog # | ABIN631295 |
|---|
| Price | |
|---|
| Order / More Info | RAD18 Homolog (S. Cerevisiae) (RAD18) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|