| Edit |   |
| Antigenic Specificity | Leucine Carboxyl Methyltransferase 2 (LCMT2) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW). |
| Immunogen | LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
| Other Names | si:ch211-194d6.3|wu:fi38a08|PPM2|TYW4|D330024M17|Tyw4 |
| Gene, Accession # | Gene ID: 9836 |
| Catalog # | ABIN631299 |
| Price | |
| Order / More Info | Leucine Carboxyl Methyltransferase 2 (LCMT2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |