| Edit |   |
|---|
| Antigenic Specificity | RHOBTB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RHOBTB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RHOBTB1. This antibody reacts with human. The RHOBTB1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to RHOBTB1(Rho-related BTB domain containing 1) The peptide sequence was selected from the middle region of RHOBTB1. Peptide sequence DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN. |
|---|
| Other Names | KIAA0740MGC33059, MGC33841, Rho-related BTB domain containing 1, rho-related BTB domain-containing protein 1 |
|---|
| Gene, Accession # | RHOBTB1, Gene ID: 9886, Accession: O94844, SwissProt: O94844 |
|---|
| Catalog # | NBP1-58908 |
|---|
| Price | |
|---|
| Order / More Info | RHOBTB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|