| 产品详情 |
| Edit |   |
| Antigenic Specificity | ASAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ASAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ASAP1. This antibody reacts with human. The ASAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ASAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT |
| Other Names | 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein, AMAP1, ARF GTPase-activating protein 1, arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1, ArfGAP with SH3 domain, ankyrin repeat and PH domain 1, centaurin, beta 4, CENTB4, DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1, development and differentiation enhancing factor 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, KIAA1249DEF-1, PAG2, PAP, PIP2-dependent ARF1 GAP, ZG14P |
| Gene, Accession # | ASAP1, Gene ID: 50807 |
| Catalog # | NBP2-48519 |
| Price | |
| Order / More Info | ASAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|