| Edit |   |
|---|
| Antigenic Specificity | Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. |
|---|
| Immunogen | COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK |
|---|
| Other Names | GB20012|COX4|COX4-1|COXIV|AL024441|Cox4|Cox4a|mg:bb02d03|zgc:110058|COX4-2|COX4B|COX4L2|COXIV-2|dJ857M17.2 |
|---|
| Gene, Accession # | Gene ID: 1327 |
|---|
| Catalog # | ABIN630318 |
|---|
| Price | |
|---|
| Order / More Info | Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|