| Edit |   |
|---|
| Antigenic Specificity | CCDC144NL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC144NL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC144NL. This antibody reacts with human. The CCDC144NL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CCDC144NL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPG EYCHLHEQRVHHHIFARGKRKGKNHVSNVV |
|---|
| Other Names | coiled-coil domain containing 144 family, N-terminal like, MGC87631, putative coiled-coil domain-containing protein 144 N-terminal-like |
|---|
| Gene, Accession # | CCDC144NL, Gene ID: 339184 |
|---|
| Catalog # | NBP2-14448 |
|---|
| Price | |
|---|
| Order / More Info | CCDC144NL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|