| Edit |   |
|---|
| Antigenic Specificity | CCDC144NL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC144NL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC144NL. This antibody reacts with human. The CCDC144NL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC87631 (coiled-coil domain containing 144 family, N-terminal like) The peptide sequence was selected from the middle region of MGC87631. Peptide sequence VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVAC |
|---|
| Other Names | coiled-coil domain containing 144 family, N-terminal like, MGC87631, putative coiled-coil domain-containing protein 144 N-terminal-like |
|---|
| Gene, Accession # | CCDC144NL, Gene ID: 339184, Accession: Q6NUI1, SwissProt: Q6NUI1 |
|---|
| Catalog # | NBP1-57054-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC144NL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|