| Edit |   |
| Antigenic Specificity | ARID5A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARID5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARID5A. This antibody reacts with human. The ARID5A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptide directed towards the C terminal of human ARID5AThe immunogen for this antibody is ARID5A. Peptide sequence MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL. |
| Other Names | ARID domain-containing protein 5A, AT rich interactive domain 5A (MRF1-like), AT-rich interactive domain-containing protein 5A, RFVG5814 |
| Gene, Accession # | ARID5A, Gene ID: 10865, Accession: NP_997646, SwissProt: NP_997646 |
| Catalog # | NBP1-79441 |
| Price | |
| Order / More Info | ARID5A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |