产品详情 |
Edit |   |
Antigenic Specificity | CTCF |
Clone | CBXC-1870 |
Host Species | Recombinant Mouse |
Reactive Species | human |
Isotype | IgG2a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | WB, IHC, IHC-P |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-CTCF Recombinant Antibody (CBXC-1870). This product is a mouse antibody that recognizes CTCF. The antibody CBXC-1870 can be used for immunoassay techniques such as: WB, IHC, IHC-P. CTCF (CCCTC-Binding Factor) is a Protein Coding gene. Diseases associated with CTCF include Mental Retardation, Autosomal Dominant 21 and Spherocytosis, Type 4. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways. Gene Ontology (GO) annotations related to this gene include DNA binding transcription factor activity and chromatin binding. An important paralog of this gene is CTCFL. |
Immunogen | Recombinant protein corresponding to amino acids: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP |
Other Names | CCCTC-Binding Factor; CCCTC-Binding Factor (Zinc Finger Protein); 11 Zinc Finger Transcriptional Repressor; 11-Zinc Finger Protein; CTCFL Paralog; Transcriptional Repressor CTCF; MRD21; |
Gene, Accession # | Gene ID: 10664, UniProt: P49711 |
Catalog # | CBMAB-C5096-CQ |
Price | |
Order / More Info | CTCF Antibody from CREATIVE BIOLABS |
Product Specific References | n/a |
产品资料 |
|
|