| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HIPPI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIPPI Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIPPI. This antibody reacts with human. The HIPPI Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HIPPI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPN |
|---|
| Other Names | Dermal papilla-derived protein 8, DERP8, ESRRBL1huntingtin interacting protein-1 interacting protein, estrogen-related receptor beta like 1, Estrogen-related receptor beta-like protein 1, FLJ10147, HIPPIHIP1-interacting protein, intraflagellar transport 57 homolog (Chlamydomonas), intraflagellar transport protein 57 homolog, MHS4R2HIP1 protein interactor |
|---|
| Gene, Accession # | IFT57, Gene ID: 55081 |
|---|
| Catalog # | NBP1-84788 |
|---|
| Price | |
|---|
| Order / More Info | HIPPI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|