| Edit |   |
|---|
| Antigenic Specificity | GLE1 RNA Export Mediator Homolog (Yeast) (GLE1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. |
|---|
| Immunogen | GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ |
|---|
| Other Names | Dmel\\CG14749|GLE1|GLE1L|LCCS|LCCS1|hGLE1|Gle1l|4933405K21Rik|AA553313 |
|---|
| Gene, Accession # | Gene ID: 2733 |
|---|
| Catalog # | ABIN630876 |
|---|
| Price | |
|---|
| Order / More Info | GLE1 RNA Export Mediator Homolog (Yeast) (GLE1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|