| Edit |   |
| Antigenic Specificity | Nucleoporin 155kDa (NUP155) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. |
| Immunogen | NUP155 antibody was raised using the middle region of NUP155 corresponding to a region with amino acids ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEY |
| Other Names | F10B6.25|F10B6_25|nucleoporin 155|DDBDRAFT_0189286|DDBDRAFT_0235243|DDB_0189286|DDB_0235243|D930027M19Rik|mKIAA0791|zgc:55435|N155 |
| Gene, Accession # | Gene ID: 9631 |
| Catalog # | ABIN630700 |
| Price | |
| Order / More Info | Nucleoporin 155kDa (NUP155) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |