| Edit |   |
|---|
| Antigenic Specificity | RAN, Member RAS Oncogene Family (RAN) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog, C. elegans, Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. |
|---|
| Immunogen | Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA |
|---|
| Other Names | ara24|gsp1|ran-1|tc4|RAN|xran|AAF30287|CG1404|DmelCG1404|Ran|dran|l(1)G0075|ran10A|ran|ARA24|Gsp1|TC4|RANP1|M2|Ran/M2|Rasl2-9-ps|fc16b04|wu:fc16b04 |
|---|
| Gene, Accession # | Gene ID: 44072,5901,442976,19428,84509 |
|---|
| Catalog # | ABIN634102 |
|---|
| Price | |
|---|
| Order / More Info | RAN, Member RAS Oncogene Family (RAN) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|