| Edit |   |
|---|
| Antigenic Specificity | SRGAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SRGAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SRGAP1. This antibody reacts with mouse. The SRGAP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human Srgap1The immunogen for this antibody is Srgap1. Peptide sequence DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG. |
|---|
| Other Names | ARHGAP13srGAP1, FLJ22166, KIAA1304SLIT-ROBO Rho GTPase-activating protein 1, Rho GTPase-activating protein 13, SLIT-ROBO Rho GTPase activating protein 1 |
|---|
| Gene, Accession # | SRGAP1, Gene ID: 57522, Accession: AAL27030 |
|---|
| Catalog # | NBP1-79674-20ul |
|---|
| Price | |
|---|
| Order / More Info | SRGAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|