| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 4 (RBM4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain. |
|---|
| Immunogen | RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY |
|---|
| Other Names | rbm4|rna-bp4|wu:fc31f07|wu:fc57h11|zgc:56302|LARK|RBM4A|ZCCHC21|ZCRB3A|4921506I22Rik|Lark1|Mlark|Rbm4a|lark|Rbm4 |
|---|
| Gene, Accession # | Gene ID: 5936,19653,293663 |
|---|
| Catalog # | ABIN633396 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 4 (RBM4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|