| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 45 (RBM45) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains. |
|---|
| Immunogen | RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT |
|---|
| Other Names | drb1|drbp1|MGC53228|RBM45|si:ch211-222f23.2|DKFZp459H0661|zgc:154147|DRB1|Drb1|Drbp1|G430095G15Rik |
|---|
| Gene, Accession # | Gene ID: 129831,266631 |
|---|
| Catalog # | ABIN633300 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 45 (RBM45) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|