| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 7 (RBM7) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis. |
|---|
| Immunogen | RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR |
|---|
| Other Names | 1200007M24Rik|1500011D06Rik|AU041934|AW554393 |
|---|
| Gene, Accession # | Gene ID: 10179 |
|---|
| Catalog # | ABIN633432 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 7 (RBM7) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|