| Edit |   |
|---|
| Antigenic Specificity | RNA Binding Motif Protein 38 (RBM38) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | RBM38 is a probable RNA-binding protein. |
|---|
| Immunogen | RBM38 antibody was raised using the N terminal of RBM38 corresponding to a region with amino acids LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER |
|---|
| Other Names | rnpc1|seb4b|seb4d|XSeb4R|MGC89204|hsrnaseb|YF-55|fi25e12|wu:fi25e12|zgc:92336|xseb4r|HSRNASEB|RNPC1|SEB4B|SEB4D|dJ800J21.2|Rnpc1|Seb4|Seb4l |
|---|
| Gene, Accession # | Gene ID: 333991,55544,611796,56190,366262 |
|---|
| Catalog # | ABIN633487 |
|---|
| Price | |
|---|
| Order / More Info | RNA Binding Motif Protein 38 (RBM38) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|