| 产品详情 |
| Edit |   |
| Antigenic Specificity | Dehydrodolichyl Diphosphate Synthase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Dehydrodolichyl Diphosphate Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dehydrodolichyl Diphosphate Synthase. This antibody reacts with human. The Dehydrodolichyl Diphosphate Synthase Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Dehydrodolichyl Diphosphate Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA |
| Other Names | cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS |
| Gene, Accession # | DHDDS, Gene ID: 79947 |
| Catalog # | NBP1-84975 |
| Price | |
| Order / More Info | Dehydrodolichyl Diphosphate Synthase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 21295282 |
| 产品资料 |
|
|