| Edit |   |
|---|
| Antigenic Specificity | Dehydrodolichyl Diphosphate Synthase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dehydrodolichyl Diphosphate Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dehydrodolichyl Diphosphate Synthase. This antibody reacts with human. The Dehydrodolichyl Diphosphate Synthase Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR. |
|---|
| Other Names | cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS |
|---|
| Gene, Accession # | DHDDS, Gene ID: 79947, Accession: Q86SQ9, SwissProt: Q86SQ9 |
|---|
| Catalog # | NBP1-55231-20ul |
|---|
| Price | |
|---|
| Order / More Info | Dehydrodolichyl Diphosphate Synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|