| Edit |   |
|---|
| Antigenic Specificity | Annexin A5 (ANXA5) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | n/a |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. |
|---|
| Immunogen | Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE |
|---|
| Other Names | anx|anx5|ANX V|anxa5|cb989|wu:fa98f06|wu:fj10f10|MGC89158|ANX5|ENX2|PP4|RPRGL3|Anx5|R74653|LC5|enx2 |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630241 |
|---|
| Price | |
|---|
| Order / More Info | Annexin A5 (ANXA5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|