| Edit |   |
|---|
| Antigenic Specificity | Dehydrodolichyl Diphosphate Synthase (DHDDS) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. |
|---|
| Immunogen | DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR |
|---|
| Other Names | wu:fd56c06|zgc:77088|CIT|CPT|DS|HDS|RP59|3222401G21Rik|W91638 |
|---|
| Gene, Accession # | Gene ID: 79947 |
|---|
| Catalog # | ABIN631604 |
|---|
| Price | |
|---|
| Order / More Info | Dehydrodolichyl Diphosphate Synthase (DHDDS) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|