| Edit |   |
| Antigenic Specificity | ELMOD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ELMOD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELMOD1. This antibody reacts with human. The ELMOD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ELMOD1The immunogen for this antibody is ELMOD1. Peptide sequence CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI. |
| Other Names | DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1 |
| Gene, Accession # | ELMOD1, Gene ID: 55531, Accession: NP_001123509, SwissProt: NP_001123509 |
| Catalog # | NBP1-79667-20ul |
| Price | |
| Order / More Info | ELMOD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |