| Edit |   |
|---|
| Antigenic Specificity | ELMOD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELMOD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ELMOD1. This antibody reacts with human. The ELMOD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ELMOD1The immunogen for this antibody is ELMOD1. Peptide sequence CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI. |
|---|
| Other Names | DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1 |
|---|
| Gene, Accession # | ELMOD1, Gene ID: 55531, Accession: NP_001123509, SwissProt: NP_001123509 |
|---|
| Catalog # | NBP1-79667 |
|---|
| Price | |
|---|
| Order / More Info | ELMOD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|