| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LSS |
|---|
| Clone | 2E4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LSS Antibody (2E4) from Novus Biologicals is a mouse monoclonal antibody to LSS. This antibody reacts with human. The LSS Antibody (2E4) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | LSS (NP_001001438.1 633 a.a. - 732 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP |
|---|
| Other Names | EC 5.4.99.7, FLJ350152,3-epoxysqualene--lanosterol cyclase, FLJ39450, FLJ46393, hOSC, human lanosterol synthase, EC 5.4.99.710EC 5.4.99, lanosterol synthase, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase, OSCFLJ25486, Oxidosqualene--lanosterol cyclase |
|---|
| Gene, Accession # | LSS, Gene ID: 4047, Accession: NP_001001438, SwissProt: NP_001001438 |
|---|
| Catalog # | H00004047-M01 |
|---|
| Price | |
|---|
| Order / More Info | LSS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|