| Edit |   |
| Antigenic Specificity | PSCA |
| Clone | 5C2 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSCA Antibody (5C2) from Novus Biologicals is a mouse monoclonal antibody to PSCA. This antibody reacts with human. The PSCA Antibody (5C2) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | PSCA (NP_005663, 23 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
| Other Names | PRO232, prostate stem cell antigen |
| Gene, Accession # | PSCA, Gene ID: 8000, Accession: NP_005663, SwissProt: NP_005663 |
| Catalog # | H00008000-M03 |
| Price | |
| Order / More Info | PSCA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |