| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSG9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSG9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSG9. This antibody reacts with human. The PSG9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PSG9(pregnancy specific beta-1-glycoprotein 9) The peptide sequence was selected from the N terminal of PSG9. Peptide sequence YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI. |
|---|
| Other Names | pregnancy specific beta-1-glycoprotein 9, Pregnancy-specific beta-1 glycoprotein B, Pregnancy-specific beta-1-glycoprotein 11, pregnancy-specific beta-1-glycoprotein 9, Pregnancy-specific glycoprotein 11, Pregnancy-specific glycoprotein 7, Pregnancy-specific glycoprotein 9, PS34, PS-beta-B, PS-beta-G-11, PS-beta-G-9, PSBG-11, PSBG-9, PSG11pregnancy specific beta-1-glycoprotein 11, PSG7, PSGII |
|---|
| Gene, Accession # | PSG9, Gene ID: 5678, Accession: Q00887, SwissProt: Q00887 |
|---|
| Catalog # | NBP1-57676 |
|---|
| Price | |
|---|
| Order / More Info | PSG9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|