| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNA helicase HEL308 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNA helicase HEL308 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA helicase HEL308. This antibody reacts with human. The DNA helicase HEL308 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNA helicase HEL308 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ECLVLGGGDTNPDLLRHMPTDRGVGDQPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKHATDFATENLCSE |
|---|
| Other Names | EC 3.6.1, EC 3.6.4.12, Hel308, HEL308DNA helicase HEL308, helicase POLQ-like, helicase, POLQ-like, MGC20604, Mus308-like helicase, POLQ-like helicase |
|---|
| Gene, Accession # | HELQ, Gene ID: 113510 |
|---|
| Catalog # | NBP1-91842 |
|---|
| Price | |
|---|
| Order / More Info | DNA helicase HEL308 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|