| Edit |   |
|---|
| Antigenic Specificity | DNAH10OS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 31%, rat 36%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human DNAH10OS polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL |
|---|
| Other Names | dynein, axonemal, heavy chain 10 opposite strand, FLJ45278 |
|---|
| Gene, Accession # | Gene ID: None, UniProt: P0CZ25, ENSG00000250091 |
|---|
| Catalog # | HPA039786 |
|---|
| Price | |
|---|
| Order / More Info | DNAH10OS Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|