| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTGER3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTGER3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTGER3. This antibody reacts with human. The PTGER3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PTGER3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS |
|---|
| Other Names | EP3EP3e, EP3-I, EP3-II, EP3-III, EP3-IV, MGC141828, MGC141829, MGC27302, PGE receptor EP3 subtype, PGE receptor, EP3 subtype, PGE2 receptor EP3 subtype, PGE2-R, prostaglandin E receotor EP3 subtype 3 isoform, prostaglandin E receptor 3 (subtype EP3), prostaglandin E2 receptor EP3 subtype, prostaglandin receptor (PGE-2), Prostanoid EP3 receptor |
|---|
| Gene, Accession # | PTGER3, Gene ID: 5733 |
|---|
| Catalog # | NBP1-84835 |
|---|
| Price | |
|---|
| Order / More Info | PTGER3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23227994 |
|---|
| 产品资料 |
|
|