| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPS6KC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPS6KC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPS6KC1. This antibody reacts with human. The RPS6KC1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RPS6KC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWA |
|---|
| Other Names | EC 2.7.11.1, humS6PKh1, ribosomal protein S6 kinase delta-1, ribosomal protein S6 kinase, 52kD, polypeptide 1,52 kDa ribosomal protein S6 kinase, ribosomal protein S6 kinase, 52kDa, polypeptide 1, Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein, RPK118, S6K-delta-1, SPHK1-binding protein |
|---|
| Gene, Accession # | RPS6KC1, Gene ID: 26750 |
|---|
| Catalog # | NBP2-54999 |
|---|
| Price | |
|---|
| Order / More Info | RPS6KC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|