| 产品详情 |
| Edit |   |
| Antigenic Specificity | Hsp90 beta |
| Clone | n/a |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Anti-Hsp90 beta Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
| Other Names | heat shock protein HSP 90-beta isoform a; Heat shock protein HSP 90-beta; heat shock protein HSP 90-beta; heat shock protein 90kDa alpha family class B member 1; Heat shock 84 kDa; HSP 84; HSP84, HSP90AB1; HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B; HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84 |
| Gene, Accession # | Gene ID: 3326, NCBI: NP_001258898.1, UniProt: P08238 |
| Catalog # | MBS177979 |
| Price | |
| Order / More Info | Hsp90 beta Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1. 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). The HSP90 family of genes in the human genome: insights into their divergence and evolution. Genomics 86 (6): 627-37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene. The Journal of Biological Chemistry 264 (25): 15006-11. |
| 产品资料 |
|
|