| Edit |   |
|---|
| Antigenic Specificity | Dicarbonyl/L-Xylulose Reductase (DCXR) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities. |
|---|
| Immunogen | DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM |
|---|
| Other Names | dcxr|DCXR|wu:fa12f09|zgc:111977|0610038K04Rik|1810027P18Rik|glb|GLB|DCR|HCR2|HCRII|KIDCR|P34H|SDR20C1|XR|DER|EBP|ELNR1|MPS4B|AW125515|Bge|Bgl|Bgl-e|Bgl-s|Bgl-t|Bgs|Bgt|C130097A14Rik |
|---|
| Gene, Accession # | Gene ID: 51181,67880,171408 |
|---|
| Catalog # | ABIN631837 |
|---|
| Price | |
|---|
| Order / More Info | Dicarbonyl/L-Xylulose Reductase (DCXR) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|