| Edit |   |
|---|
| Antigenic Specificity | Cytosol Aminopeptidase (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. |
|---|
| Immunogen | LAP3 antibody was raised using the N terminal of LAP3 corresponding to a region with amino acids LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN |
|---|
| Other Names | LAP|LAPEP|PEPS|2410015L10Rik|AA410100|LAP-3|Lap|Lapep|Pep-7|Pep-S|Pep7|Peps |
|---|
| Gene, Accession # | Gene ID: 51056,66988,289668 |
|---|
| Catalog # | ABIN631475 |
|---|
| Price | |
|---|
| Order / More Info | Cytosol Aminopeptidase (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|