| Edit |   |
| Antigenic Specificity | Isoprenylcysteine Carboxyl Methyltransferase (ICMT) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined. |
| Immunogen | ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI |
| Other Names | im:6895697|zgc:110258|HSTE14|MST098|MSTP098|PCCMT|PCMT|PPMT|1700008E11Rik|C80758|Gm13095|OTTMUSG00000010406|STE14|pcCMT|fcmt |
| Gene, Accession # | Gene ID: 23463,57295,170818 |
| Catalog # | ABIN635975 |
| Price | |
| Order / More Info | Isoprenylcysteine Carboxyl Methyltransferase (ICMT) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |