| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCA12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABCA12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCA12. This antibody reacts with human. The ABCA12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRRKGIDDALFKDSEILRKSSNLDKDSSLSFQSTQVPERRHASLATVFPSPSSDLEIPGTYTFNGSQVLARILGLEKLLKQNSTSEDI |
|---|
| Other Names | ABC12, ATP-binding cassette 12, ATP-binding cassette transporter 12, ATP-binding cassette, sub-family A (ABC1), member 12, DKFZP434G232, EC 3.6.3, EC 3.6.3.25, FLJ41584, ichthyosis congenita II, lamellar ichthyosis B, ICR2B, LI2ATP-binding cassette sub-family A member 12 |
|---|
| Gene, Accession # | ABCA12, Gene ID: 26154 |
|---|
| Catalog # | NBP2-69062 |
|---|
| Price | |
|---|
| Order / More Info | ABCA12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|