| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ABCA8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ABCA8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABCA8. This antibody reacts with human. The ABCA8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ABCA8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA |
|---|
| Other Names | ATP-binding cassette sub-family A member 8, ATP-binding cassette, sub-family A (ABC1), member 8, EC 3.6.3, EC 3.6.3.41, KIAA0822MGC163152 |
|---|
| Gene, Accession # | ABCA8, Gene ID: 10351, Accession: O94911, SwissProt: O94911 |
|---|
| Catalog # | NBP1-91641 |
|---|
| Price | |
|---|
| Order / More Info | ABCA8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|